DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and Ppp3r2

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001004025.1 Gene:Ppp3r2 / 19059 MGIID:107171 Length:179 Species:Mus musculus


Alignment Length:175 Identity:62/175 - (35%)
Similarity:92/175 - (52%) Gaps:18/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMP 65
            |||:....||.       |..|.::||.|:.|.||:|..|         ::.|:.:  |...::|
Mouse     1 MGNEASYQTEL-------CNHFDQEEIRRLGKSFRKLDLD---------KSGSLSI--EEFMRLP 47

  Fly    66 ELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADL 130
            ||::||...|:.:.|..||.|.:.|.:|:...|.||.:...:.|:.:||:|||.|.||||.:.:|
Mouse    48 ELQQNPLVGRVIDIFDTDGNGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGEL 112

  Fly   131 MSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVI 175
            ...|..|..|.|...:.||:.||.|...|.||||::|..||..|:
Mouse   113 FQVLKMMVGNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 56/156 (36%)
Ppp3r2NP_001004025.1 PTZ00184 17..153 CDD:185504 52/146 (36%)
EFh 25..76 CDD:238008 18/61 (30%)
EFh 91..158 CDD:238008 30/67 (45%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:Q63810 131..136 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.