DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and ncs-4

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_509708.2 Gene:ncs-4 / 184757 WormBaseID:WBGene00008998 Length:224 Species:Caenorhabditis elegans


Alignment Length:174 Identity:40/174 - (22%)
Similarity:81/174 - (46%) Gaps:16/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELRENPF 72
            |....|....|.|.|::.|:..:::.|:|..|:.|..:....:..:...|...||...:|     
 Worm    40 FRPSSLQQVVDETHFSKNEVRAIYRAFKETSPNAVINKNIMREKFAELFPHGDIEHYSDL----- 99

  Fly    73 RRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSCLTTM 137
               :.|.|..||.|.::|::|:.|||:.. :...|.|:.:.:|:||..:.|.:....|...:|:|
 Worm   100 ---LFETFDNDGNGTINFQEFVKALSILC-RGTLDEKLDWLYKLYDPKEKGEVTWDRLFYVITSM 160

  Fly   138 -------TKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHV 174
                   .:...:.|:..::.::|..:.||...|:::..:|.|:
 Worm   161 DDLMGKHARPHHTREQKCELTNQVFAKFDVGKKGRITKKDFLHI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 37/162 (23%)
ncs-4NP_509708.2 FRQ1 41..211 CDD:227455 39/173 (23%)
EFh 101..149 CDD:238008 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.