DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and calm-1

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_492514.2 Gene:calm-1 / 172774 WormBaseID:WBGene00009260 Length:201 Species:Caenorhabditis elegans


Alignment Length:201 Identity:106/201 - (52%)
Similarity:141/201 - (70%) Gaps:12/201 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGN------------KVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASS 53
            |||            |...||.::||:||||||||||:|:|::|||..|.|..||..|...:.:.
 Worm     1 MGNNASSLSELNLFSKGGVFTREQLDEYQDCTFFTRKDIIRLYKRFYALNPHKVPTNMQGNRPAI 65

  Fly    54 VKVPCECIEKMPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYD 118
            ..:..|.:||||||:||||:|||||.||.||:|||||:||||..|||||.||..:|:.|||:|||
 Worm    66 TTLTFEEVEKMPELKENPFKRRICEVFSEDGRGNLSFDDFLDMFSVFSEMAPLQLKLKYAFRIYD 130

  Fly   119 FDQDGFIGHADLMSCLTTMTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLS 183
            :|.|..:||.||...:.::|::|||..|.:.|.:::|||||:|||..::..|||||:.|:|||:.
 Worm   131 YDGDELLGHDDLSKMIRSLTRDELSDVEVEFIIERIIEEADLDGDSSINFAEFEHVVSRSPDFIR 195

  Fly   184 TFHIRI 189
            ||||||
 Worm   196 TFHIRI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 85/159 (53%)
calm-1NP_492514.2 FRQ1 32..192 CDD:227455 85/159 (53%)
EFh 121..183 CDD:298682 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157896
Domainoid 1 1.000 131 1.000 Domainoid score I3222
eggNOG 1 0.900 - - E2759_KOG0038
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4653
Inparanoid 1 1.050 222 1.000 Inparanoid score I2272
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52608
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0002598
OrthoInspector 1 1.000 - - oto19853
orthoMCL 1 0.900 - - OOG6_106257
Panther 1 1.100 - - LDO PTHR45791
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4133
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.