DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CIB4

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_011530816.1 Gene:CIB4 / 130106 HGNCID:33703 Length:201 Species:Homo sapiens


Alignment Length:181 Identity:74/181 - (40%)
Similarity:102/181 - (56%) Gaps:22/181 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DDYQDCTFFTRKEILRVHKRFRELRPDLVPRQ------MTEGQASSVKVPCECIEKMPELRENPF 72
            |..|..||.||.|||.:|..|.:|.|   |.:      :|..|.||          :|.||.|||
Human    31 DLLQALTFLTRNEILCIHDTFLKLCP---PGKYYKEATLTMDQVSS----------LPALRVNPF 82

  Fly    73 RRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMS-CLTT 136
            |.|||..||.  :|..||||.|...|||||||...:|:.|||:||||:::|||...||.. .|..
Human    83 RDRICRVFSH--KGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRL 145

  Fly   137 MTKNELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDFLSTFHI 187
            :..:::|.:....:.:.|:.|:|:|.|..||..||||.:.::|||:::|.|
Human   146 LNSDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 67/166 (40%)
CIB4XP_011530816.1 EFh 117..185 CDD:238008 26/67 (39%)
EF-hand_7 118..184 CDD:290234 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.