DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and CIB1

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_006720438.1 Gene:CIB1 / 10519 HGNCID:16920 Length:264 Species:Homo sapiens


Alignment Length:186 Identity:85/186 - (45%)
Similarity:119/186 - (63%) Gaps:8/186 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKVVTFTEQELDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMP 65
            ||......:::.|.:|||.||.|::|||..|:||.||.|.   .|.:...:...:||.|.|..:|
Human     1 MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQ---EQRSVESSLRAQVPFEQILSLP 62

  Fly    66 ELRENPFRRRICEAFSRD-GQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHAD 129
            ||:.|||:.|||..||.. .:.:||||||||.|||||:.|..|||..|||:|:|||.||.:...|
Human    63 ELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNRED 127

  Fly   130 ---LMSCLTTMTKN-ELSPEEHQQIADKVIEEADVDGDGKLSILEFEHVILRAPDF 181
               |::|||...:: .||..|.:|:.|.::||:|:|.||.:::.||:|||.|:|||
Human   128 LSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 76/164 (46%)
CIB1XP_006720438.1 EF-hand_8 82..132 CDD:290545 27/49 (55%)
EF-hand_7 109..177 CDD:290234 28/67 (42%)
EFh 111..178 CDD:238008 28/66 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156551
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.