DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and guca1b

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_002933553.1 Gene:guca1b / 100489509 XenbaseID:XB-GENE-22172599 Length:197 Species:Xenopus tropicalis


Alignment Length:116 Identity:32/116 - (27%)
Similarity:61/116 - (52%) Gaps:22/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSC 133
            |:.||     ||.::|...:.|.:::.||::.. :...:.|:.:.||:||.|.:|.|..|:|:..
 Frog    57 EHMFR-----AFDKNGDNTIDFLEYVAALNLVL-RGKLEHKLKWTFKVYDRDGNGCIDKAELLEI 115

  Fly   134 LTTMTKNE-------------LSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            :.::...:             |||||   :.:::.:..|.:|||:||:.||
 Frog   116 VESIYNLKKVCRRGQDERTPLLSPEE---VVERIFQLVDENGDGQLSLDEF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 32/116 (28%)
guca1bXP_002933553.1 FRQ1 1..166 CDD:227455 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.