DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and guca1a

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001096291.1 Gene:guca1a / 100124863 XenbaseID:XB-GENE-22061924 Length:203 Species:Xenopus tropicalis


Alignment Length:179 Identity:37/179 - (20%)
Similarity:81/179 - (45%) Gaps:36/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKMPELR-----ENPFRRRICEAFSRDGQGNLS 89
            :|:.:::...:....|:|:.:          .::...|:     .|.:..::...|..:..|.:.
 Frog    17 IHQWYKKFMTECPSGQLTQHE----------FKQFFNLKNLSPASNQYIEQMFNTFDFNKDGYMD 71

  Fly    90 FEDFLDALS-VFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSCLTTM-----TKNELSPEEHQ 148
            |.:::.||| |...:..:.:|  :.||:||.|.:|.|...:|::.:..:     ...:::.||  
 Frog    72 FMEYVAALSLVLKGKVEQKLK--WYFKLYDVDGNGCIDRGELLNIIKAIRAINRCNEDMTAEE-- 132

  Fly   149 QIADKVIEEADVDGDGKLSILEF----------EHVILRAPDFLSTFHI 187
             ..|.|.::.|::|||:||:.||          .:|:.|:.|.....|:
 Frog   133 -FTDMVFDKIDINGDGELSLEEFIEGVQRDEFLLNVLTRSLDLKHIVHM 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 35/170 (21%)
guca1aNP_001096291.1 FRQ1 11..162 CDD:227455 33/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.