DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cib2 and kcnip1a

DIOPT Version :9

Sequence 1:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_021326489.1 Gene:kcnip1a / 100008068 ZFINID:ZDB-GENE-080721-17 Length:230 Species:Danio rerio


Alignment Length:186 Identity:44/186 - (23%)
Similarity:80/186 - (43%) Gaps:32/186 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TEQELDDYQD----C------------TFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVP 57
            ||.:|||..:    |            |.|.:||:..:::.|:...|..|..:.|..|..|    
Zfish    33 TEDKLDDDLELSIVCHRPEGLEQLEAQTNFNKKELQVLYRGFKNECPSGVVNEETFKQIYS---- 93

  Fly    58 CECIEKMPELRENPFRRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQD 122
                :..|....:.:...:..||.....|::.||||:.|||:.......: |:.:.|.:||.::|
Zfish    94 ----QFFPHGDASTYAHYLFNAFDSSHNGSIKFEDFVTALSILLRGTTTE-KLEWTFNLYDINRD 153

  Fly   123 GFIGHADLMSCLTTM-------TKNELSPEEHQQIADKVIEEADVDGDGKLSILEF 171
            |:|...::|..:..:       |...|..:..:|..|...::.|.:.||.:::.||
Zfish   154 GYINKEEMMDIVKAIYDMMGRFTYPALKTDTPKQHVDAFFQKMDKNRDGVVTLDEF 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 38/159 (24%)
kcnip1aXP_021326489.1 FRQ1 53..219 CDD:227455 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.