DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk1 and IPK1

DIOPT Version :9

Sequence 1:NP_001097387.1 Gene:Ipk1 / 37360 FlyBaseID:FBgn0050295 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_010601.3 Gene:IPK1 / 851910 SGDID:S000002723 Length:281 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:25/120 - (20%)
Similarity:37/120 - (30%) Gaps:58/120 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 TYAIEIKPKQGWLQLASDVNDLFDLMPSGAVTKPKETTCNQEENEPSARDKCWCRFCSMQLLKMH 301
            |..:|:|||  ||...:|                                  :||.|:      |
Yeast   119 TVILELKPK--WLYYDTD----------------------------------YCRNCT------H 141

  Fly   302 NGKIKRLGHYC---------PLDLFSGT----PSRMLDALDALLACPQNNLRVFQ 343
            |....|...||         .|:|..|.    |.:..||:...|   :|:..:|:
Yeast   142 NAFKGRGTKYCYNQLLMNPAHLELIFGECNIFPVKFKDAMHEYL---RNDNNIFK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk1NP_001097387.1 Ins_P5_2-kin 51..>332 CDD:283696 22/107 (21%)
Ins_P5_2-kin <571..707 CDD:283696
IPK1NP_010601.3 Ins_P5_2-kin 4..265 CDD:399231 25/120 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14456
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.