DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk1 and AT1G22100

DIOPT Version :9

Sequence 1:NP_001097387.1 Gene:Ipk1 / 37360 FlyBaseID:FBgn0050295 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_173629.2 Gene:AT1G22100 / 838815 AraportID:AT1G22100 Length:441 Species:Arabidopsis thaliana


Alignment Length:347 Identity:91/347 - (26%)
Similarity:139/347 - (40%) Gaps:102/347 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IELIYRAEGNANLVLAL----PQFKKVLRLPKMISSRLRQAAHQRHELADEVARPEGQRVSSERA 107
            ::..||.||..|||||.    |.|     |.||:  |:::.....:|..|   :.|....:.|:.
plant    12 VDWSYRGEGAVNLVLAYTGSSPSF-----LGKMM--RIQKMPKDGNENGD---KSENGLTTHEKL 66

  Fly   108 GTENAGDLT------MPDFMAYIGIMRRLLGNEFVCGADIVAIPKEDDRFW--INEHIRAQRPVS 164
            ...:..||.      :.:::....:||.|||.:.|....::.:.||   |.  :.:.|.:|||..
plant    67 IWGDVKDLVSCKNKEIEEYLFVKHVMRPLLGRKHVNPGILLLVAKE---FLESVEKIITSQRPSW 128

  Fly   165 RLDKEFVG---PFGLLLPDVTQLPATFDVLLANLQAKGTTGDESGAAAGVGDGGGVGRGAGTRTK 226
            |.|...|.   ...||:.|:|            |.|.|...|:                      
plant   129 RADVASVDTNRSSVLLMDDLT------------LFAHGHVEDK---------------------- 159

  Fly   227 NRSAVRRLGDTYAIEIKPKQGWLQLASDVNDLFDLMPSGAVTKPKETTCNQEENEPSARDKCWCR 291
                     ...::|||||.|:|..:|.:                     .|||   ...|...|
plant   160 ---------PCLSVEIKPKCGFLPSSSFI---------------------AEEN---VIKKSITR 191

  Fly   292 FCSMQLLKMHNGKIKRLGHYCPLDLFSGTPSRMLDALDALLACPQNNLRVFQNSNLIYGDHANSI 356
            |...|:||:...:|..:..|.|||||||:..|:|:|:.||...||||.|||.|.:|::|.....|
plant   192 FEMHQVLKLRENEISEISEYDPLDLFSGSKERILEAIKALYTTPQNNFRVFLNGSLVFGGLGGGI 256

  Fly   357 SFDELSSRVFPGEIMVLIKHLL 378
            .  :.:|:|     .:..:|:|
plant   257 C--KTTSKV-----ELAFEHIL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk1NP_001097387.1 Ins_P5_2-kin 51..>332 CDD:283696 75/295 (25%)
Ins_P5_2-kin <571..707 CDD:283696
AT1G22100NP_173629.2 Ins_P5_2-kin 16..422 CDD:399231 91/343 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3563
eggNOG 1 0.900 - - E1_KOG4749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195478at2759
OrthoFinder 1 1.000 - - FOG0004384
OrthoInspector 1 1.000 - - otm3183
orthoMCL 1 0.900 - - OOG6_104286
Panther 1 1.100 - - O PTHR14456
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3668
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.