DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk1 and IPK1

DIOPT Version :9

Sequence 1:NP_001097387.1 Gene:Ipk1 / 37360 FlyBaseID:FBgn0050295 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_568613.1 Gene:IPK1 / 834292 AraportID:AT5G42810 Length:451 Species:Arabidopsis thaliana


Alignment Length:317 Identity:88/317 - (27%)
Similarity:130/317 - (41%) Gaps:85/317 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IYRAEGNANLVLAL----PQF-KKVLRLPKMISSRLRQAAHQRHELADEVARPEGQ--RVSSERA 107
            |||.||.||||||.    |.| .||:|:.|  :.|..:|....:.:...:...|..  |.::|..
plant    14 IYRGEGGANLVLAYAGSSPLFVGKVIRIQK--ARRNDKAIKNANGVVSVLTSDEQHLWRENNELI 76

  Fly   108 GTENAGDLTMPDFMAYI-GIMRRLLGNEFVCGADIVAIPKEDDRF--WINEHIRAQRPVSRLDKE 169
            .:.|...|.    ..|: .::..|||.:.|.....|::.||   |  .:::.:..|||:.|:   
plant    77 SSPNKEVLE----QRYVKNVIIPLLGPKHVDAGVRVSVSKE---FLECVDKKVTKQRPLWRV--- 131

  Fly   170 FVGPFGLLLPDVTQLPATFD-VLLANLQAKGTTGDESGAAAGVGDGGGVGRGAGTRTKNRSAVRR 233
                      :...:..:.| .|:.|        |.|..:.|:..|                   
plant   132 ----------NAANVDTSHDSALILN--------DHSLFSQGISSG------------------- 159

  Fly   234 LGDTYAIEIKPKQGWLQLASDVNDLFDLMPSGAVTKPKETTCNQEENEPSARDKCWCRFCSMQLL 298
             ||..::|||||.|:|..:..:.              ||   |..:...|       ||...|||
plant   160 -GDCISVEIKPKCGFLPTSRFIG--------------KE---NMLKTSVS-------RFKMHQLL 199

  Fly   299 KMHNGKIKRLGHYCPLDLFSGTPSRMLDALDALLACPQNNLRVFQNSNLIYGDHANS 355
            |:...:|.....|.|||||||:...:|:|:.||.:.||||.|||.|.:||.|....|
plant   200 KLEYNEISEESEYDPLDLFSGSKESVLEAIKALYSTPQNNFRVFLNGSLILGGSGES 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk1NP_001097387.1 Ins_P5_2-kin 51..>332 CDD:283696 74/291 (25%)
Ins_P5_2-kin <571..707 CDD:283696
IPK1NP_568613.1 Ins_P5_2-kin 15..425 CDD:283696 87/316 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I3563
eggNOG 1 0.900 - - E1_KOG4749
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195478at2759
OrthoFinder 1 1.000 - - FOG0004384
OrthoInspector 1 1.000 - - otm3183
orthoMCL 1 0.900 - - OOG6_104286
Panther 1 1.100 - - LDO PTHR14456
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3668
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.