DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ipk1 and ipk1

DIOPT Version :9

Sequence 1:NP_001097387.1 Gene:Ipk1 / 37360 FlyBaseID:FBgn0050295 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_588080.1 Gene:ipk1 / 2538790 PomBaseID:SPCC4B3.10c Length:640 Species:Schizosaccharomyces pombe


Alignment Length:307 Identity:62/307 - (20%)
Similarity:90/307 - (29%) Gaps:142/307 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ELIYRAEGNANLVLAL----PQFK-KVLRLPKMISSRLRQAAHQRHELADEVARPEGQRVSSERA 107
            |..|.|.|:||:|...    |.|: ||:||                       |..||..::|:.
pombe   389 EWAYLASGSANVVFEYVGKNPYFQDKVIRL-----------------------RRRGQVFTTEQV 430

  Fly   108 GTENAGDLTMPDFMAYIGIMRRLLGNEFVCGADIVAIPKEDDRFWINEHIRAQRPVSRLDKEFVG 172
                        :..|..::..|                                       |.|
pombe   431 ------------YEYYQNVIYPL---------------------------------------FAG 444

  Fly   173 PFGLLLPDVTQLPATFDVLLANLQAKGTTGDESGAAAGVGDGGGVGRGAGTRTKNRSAVRRLGDT 237
            ....|: :|...|.|.|.|||...|.|                              ....|.:.
pombe   445 MESFLI-EVFLQPVTRDFLLAAQNASG------------------------------IYLNLNEQ 478

  Fly   238 YAIEIKPKQGWLQLASDVNDLFDLMPSGAVTKPKETTCNQEENEPSA-RDKCWCRFCSMQLLKMH 301
            |.:.:|             ||.|    |...|||..|     ..|:| .|...||.|::..::  
pombe   479 YCLVMK-------------DLKD----GIEMKPKWLT-----QSPAAPPDWVVCRTCALSRMR-- 519

  Fly   302 NGKIKRLGHYCPLDL-FSGTPSRMLDALDALLACPQNNLRVFQNSNL 347
                .|...:|||.| |:..| :.|..|...:: |...:|:||:..|
pombe   520 ----GRPVGFCPLQLDFNNWP-KFLCCLQGFVS-PDIAMRLFQSGIL 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ipk1NP_001097387.1 Ins_P5_2-kin 51..>332 CDD:283696 56/287 (20%)
Ins_P5_2-kin <571..707 CDD:283696
ipk1NP_588080.1 BAR_Rvs167p 24..230 CDD:153283
Ins_P5_2-kin 392..615 CDD:283696 61/304 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14456
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.