| Sequence 1: | NP_000208.2 | Gene: | KCNA1 / 3736 | HGNCID: | 6218 | Length: | 495 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_010788.1 | Gene: | RPL37B / 852111 | SGDID: | S000002908 | Length: | 88 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 56 | Identity: | 15/56 - (26%) |
|---|---|---|---|
| Similarity: | 19/56 - (33%) | Gaps: | 15/56 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Human 17 GHPQDGSYPRQADHDDHECCERVVINISGLR-FETQLKTLAQFPNTLLGNPKKRMR 71 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| KCNA1 | NP_000208.2 | Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P10499 | 1..128 | 15/56 (27%) | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..30 | 3/12 (25%) | |||
| BTB_POZ | 37..163 | CDD:453885 | 10/36 (28%) | ||
| Ion_trans | 166..418 | CDD:459842 | |||
| S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 | 310..323 | ||||
| Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 | 372..377 | ||||
| PDZ-binding. /evidence=ECO:0000250 | 493..495 | ||||
| RPL37B | NP_010788.1 | PTZ00073 | 1..83 | CDD:240257 | 15/56 (27%) |
| Blue background indicates that the domain is not in the aligned region. | |||||