DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA1 and RPL37A

DIOPT Version :10

Sequence 1:NP_000208.2 Gene:KCNA1 / 3736 HGNCID:6218 Length:495 Species:Homo sapiens
Sequence 2:NP_013286.1 Gene:RPL37A / 850882 SGDID:S000004175 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:59 Identity:15/59 - (25%)
Similarity:21/59 - (35%) Gaps:15/59 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    17 GHPQDGSYPRQADHDDHECCERVVINISGLR-FETQLKTLAQFPNTLLGNPKKRMRYFD 74
            |.|..|    :..:..|..|.|     .|.| |..|.||.:.     .|.|..:.|.::
Yeast     4 GTPSFG----KRHNKSHTLCNR-----CGRRSFHVQKKTCSS-----CGYPAAKTRSYN 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA1NP_000208.2 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P10499 1..128 15/59 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 3/12 (25%)
BTB_POZ 37..163 CDD:453885 10/39 (26%)
Ion_trans 166..418 CDD:459842
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 310..323
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 372..377
PDZ-binding. /evidence=ECO:0000250 493..495
RPL37ANP_013286.1 PTZ00073 1..85 CDD:240257 15/59 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.