DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA1 and RpL37-2

DIOPT Version :10

Sequence 1:NP_000208.2 Gene:KCNA1 / 3736 HGNCID:6218 Length:495 Species:Homo sapiens
Sequence 2:NP_611757.1 Gene:RpL37-2 / 37669 FlyBaseID:FBgn0034822 Length:89 Species:Drosophila melanogaster


Alignment Length:39 Identity:11/39 - (28%)
Similarity:15/39 - (38%) Gaps:12/39 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    69 RMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVN 107
            ||||...||..:   ||.         .:.||..::..|
  Fly    63 RMRYLKNLRRRF---RNG---------LREGGAAKKKTN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA1NP_000208.2 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P10499 1..128 11/39 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
BTB_POZ 37..163 CDD:453885 11/39 (28%)
Ion_trans 166..418 CDD:459842
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 310..323
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 372..377
PDZ-binding. /evidence=ECO:0000250 493..495
RpL37-2NP_611757.1 PTZ00073 1..89 CDD:240257 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.