DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNA1 and RpL37-1

DIOPT Version :10

Sequence 1:NP_000208.2 Gene:KCNA1 / 3736 HGNCID:6218 Length:495 Species:Homo sapiens
Sequence 2:NP_573005.1 Gene:RpL37-1 / 32446 FlyBaseID:FBgn0030616 Length:93 Species:Drosophila melanogaster


Alignment Length:42 Identity:10/42 - (23%)
Similarity:15/42 - (35%) Gaps:9/42 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    33 HECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFD 74
            |..|.|    .....:..|..|.||     .|.|..::|.::
  Fly    16 HTLCRR----CGRSSYHIQKSTCAQ-----CGYPAAKLRSYN 48

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNA1NP_000208.2 Tetramerization domain. /evidence=ECO:0000250|UniProtKB:P10499 1..128 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
BTB_POZ 37..163 CDD:453885 8/38 (21%)
Ion_trans 166..418 CDD:459842
S4-S5 linker. /evidence=ECO:0000250|UniProtKB:P63142 310..323
Selectivity filter. /evidence=ECO:0000250|UniProtKB:P63142 372..377
PDZ-binding. /evidence=ECO:0000250 493..495
RpL37-1NP_573005.1 PTZ00073 1..91 CDD:240257 10/42 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.