DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ACA8

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_200444.1 Gene:ACA8 / 835733 AraportID:AT5G56330 Length:350 Species:Arabidopsis thaliana


Alignment Length:151 Identity:38/151 - (25%)
Similarity:68/151 - (45%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELL 133
            :.|..|||.:.:.|::... |..|..:.|  ||..|.::|.|:.::::....|..:    |..:.
plant   165 IGKMQSPIDLRDKNVVVSN-KFGLLRSQY--LPSNTTIKNRGHDIMLKFKGGNKGI----GVTIR 222

  Fly   134 G-RYQFVEAIFKWGSLKSEHSIGKHNFCLELQALHRCAQLNNNFEYLTLSYLFALS------HVK 191
            | |||..:  ..|.| .|||:|....|.||...:|.    :.:..|..:::|:.|.      ...
plant   223 GTRYQLQQ--LHWHS-PSEHTINGKRFALEEHLVHE----SKDKRYAVVAFLYNLGASDPFLFSL 280

  Fly   192 NEHLKQVTD------HLKWIS 206
            .:.||::||      |::.:|
plant   281 EKQLKKITDTHASEEHIRTVS 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 38/151 (25%)
ACA8NP_200444.1 alpha_CA_prokaryotic_like 149..333 CDD:239398 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.