DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ACA3

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_196038.1 Gene:ACA3 / 830296 AraportID:AT5G04180 Length:277 Species:Arabidopsis thaliana


Alignment Length:249 Identity:57/249 - (22%)
Similarity:96/249 - (38%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RLEMKL---AKQPSPITI-PESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFM 124
            :.|.|:   .|:.|||.: |:...|.......|. |||:  |:..:|:|.|            |.
plant    43 KAEWKICGTGKRQSPINLTPKIARIVHNSTEILQ-TYYK--PVEAILKNRG------------FD 92

  Fly   125 PQLSGAELLGR-------YQFVEAIFKWGSLKSEHSIGKHNFCLELQALHRCAQLNNNFEYLTLS 182
            .::...:..|:       |:.|::  .|.: .|||.:......:||..:|:..:     .:|.:.
plant    93 MKVKWEDDAGKIVINDTDYKLVQS--HWHA-PSEHFLDGQRLAMELHMVHKSVE-----GHLAVI 149

  Fly   183 YLFALSHVKNEHLKQVTDHLKWIS--QPGS-SI-ELPPFHLESLLQPFG---SGYFSYEGTYDNG 240
            .:.......|..:.::.|.:..|:  |.|. || ::.|       :.||   :.::.|.|:....
plant   150 GVLFREGEPNAFISRIMDKIHKIADVQDGEVSIGKIDP-------REFGWDLTKFYEYRGSLTTP 207

  Fly   241 DVVLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNVYFN 294
            .......|.|..|:..|...|:.....  .|.|... ||.|..|||..|.||.|
plant   208 PCTEDVMWTIINKVGTVSREQIDVLTD--ARRGGYE-KNARPAQPLNGRLVYLN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 53/241 (22%)
ACA3NP_196038.1 alpha_CA_prokaryotic_like 35..257 CDD:239398 55/246 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.