DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ACA6

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_193832.1 Gene:ACA6 / 827847 AraportID:AT4G21000 Length:260 Species:Arabidopsis thaliana


Alignment Length:257 Identity:48/257 - (18%)
Similarity:99/257 - (38%) Gaps:83/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VAFILNLYSGRTIFQDVVNAVGNRRL---EMKLAKQP-------------------SPITIPES- 81
            |.|.::|:|...:|. ....:||:.|   :.|..|.|                   |||.:.:. 
plant    12 VVFFIDLFSPNILFV-YAREIGNKPLFTYKQKTEKGPAEWGKLDPQWKVCSTGKIQSPIDLTDER 75

  Fly    82 -NMIKRQLKMPLHWTYYEDLPMATVLENNGNTVI---------MRIYTANNFMPQLSGAELLGRY 136
             ::|..| .:..|:.     |.:.|:::.|:.|:         :.|:..:              |
plant    76 VSLIHDQ-ALSKHYK-----PASAVIQSRGHDVMVSWKGDGGKITIHQTD--------------Y 120

  Fly   137 QFVEAIFKWGSLKSEHSIGKHNFCLELQALHRCAQLNNNFEYLTLSYLFALSHVKNEHLKQVTDH 201
            :.|:.  .|.| .|||:|...::.|||..:|..|    :.:...:..|:.|.. .:|.|.::.:.
plant   121 KLVQC--HWHS-PSEHTINGTSYDLELHMVHTSA----SGKTTVVGVLYKLGE-PDEFLTKILNG 177

  Fly   202 LKWISQPGSSIELPPFHLESLLQPFG-----SGYFSYEGTYDNGDVVLPTT----WLINRKI 254
            :|.:.:  ..|:|      .::.|..     :.::.|.|:.    .:.|.|    |.:.:::
plant   178 IKGVGK--KEIDL------GIVDPRDIRFETNNFYRYIGSL----TIPPCTEGVIWTVQKRV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 39/225 (17%)
ACA6NP_193832.1 PLN02179 1..235 CDD:177835 48/257 (19%)
alpha_CA_prokaryotic_like 46..225 CDD:239398 38/218 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.