DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ACA1

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001319732.1 Gene:ACA1 / 824438 AraportID:AT3G52720 Length:284 Species:Arabidopsis thaliana


Alignment Length:248 Identity:48/248 - (19%)
Similarity:92/248 - (37%) Gaps:49/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELL 133
            :.|..|||.|....:........:|..||  ...||::.:..|..:        |..:.:|..::
plant    54 VGKLQSPIDIQRRQIFYNHKLNSIHREYY--FTNATLVNHVCNVAM--------FFGEGAGDVII 108

  Fly   134 GRYQFVEAIFKWGSLKSEHSIGKHNFCLELQALHRCAQLNNNFEYLTLSYLFA-------LSHVK 191
            ....:......|.: .|||.:....:..||..:|:.    .:..:..::.||.       ||.:|
plant   109 ENKNYTLLQMHWHT-PSEHHLHGVQYAAELHMVHQA----KDGSFAVVASLFKIGTEEPFLSQMK 168

  Fly   192 NEHLKQVTDHLKWISQPGSSIE---LPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLINRK 253
            .:.:|...:.||  ....:.:|   :...|:|...:.    |:.|.|:..........:|.|..|
plant   169 EKLVKLKEERLK--GNHTAQVEVGRIDTRHIERKTRK----YYRYIGSLTTPPCSENVSWTILGK 227

  Fly   254 ISVVDSRQL----SEFEALYGRNGNRNCK--NGR-----------EKQPLGNR 289
            :..:...|:    |..:..: :|.:|.|:  |||           :|:..||:
plant   228 VRSMSKEQVELLRSPLDTSF-KNNSRPCQPLNGRRVEMFHDHERVDKKETGNK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 48/248 (19%)
ACA1NP_001319732.1 alpha_CA 1..284 CDD:381753 48/248 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.