DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ACA2

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001318303.1 Gene:ACA2 / 817367 AraportID:AT2G28210 Length:276 Species:Arabidopsis thaliana


Alignment Length:251 Identity:51/251 - (20%)
Similarity:98/251 - (39%) Gaps:55/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GNRRLEMKL---AKQPSPITIPESNMIKRQLKMPLH----WTYYEDLPMATVLENNGNTVIMRIY 118
            |..|.|.|:   .:..|||     :::.:::::..|    ..:|:  |....|:|.|:.::::..
plant    53 GKLRPEWKMCGKGEMQSPI-----DLMNKRVRLVTHLKKLTRHYK--PCNATLKNRGHDMMLKFG 110

  Fly   119 TANNFMPQLSGAELLGRYQFVEAIFKWGSLKSEHSIGKHNFCLELQALHRCAQLNNNFEYLTLSY 183
            ...:....::|.|    |:.::  ..|.| .|||::....|.|||..:|.  .:|.:...:|:.|
plant   111 EEGSGSITVNGTE----YKLLQ--LHWHS-PSEHTMNGRRFALELHMVHE--NINGSLAVVTVLY 166

  Fly   184 LFA-----LSHVKNEHLKQVTDH---LKWISQPGSSIELPPFHLESLLQP----FGS-GYFSYEG 235
            ...     |..::|: |..:||.   .|::               .::.|    .|| .::.|.|
plant   167 KIGRPDSFLGLLENK-LSAITDQNEAEKYV---------------DVIDPRDIKIGSRKFYRYIG 215

  Fly   236 TYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNV 291
            :...........|.:.:|:..|...|:.........|.:   .|.|..||...|.|
plant   216 SLTTPPCTQNVIWTVVKKVRTVTKNQVKLLRVAVHDNSD---TNARPVQPTNKRVV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 47/243 (19%)
ACA2NP_001318303.1 alpha_CA_prokaryotic_like 48..270 CDD:239398 51/251 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.