DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca13

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001072448.1 Gene:ca13 / 779902 XenbaseID:XB-GENE-992707 Length:263 Species:Xenopus tropicalis


Alignment Length:262 Identity:62/262 - (23%)
Similarity:107/262 - (40%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YSGRTIFQDVVN-AVGNRRLEMKLAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNG 110
            ::|..::.|:.. |.|:|:         |||.|...:.|......||...|..|  .|.|:.|.|
 Frog    10 HNGPEVWHDLFPLANGDRQ---------SPINIITRDAIYDPSLQPLQVNYDHD--SAKVVINTG 63

  Fly   111 NTVIMRIYTANNFMPQLSGAELLGRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQL 172
            :|..|. :...:....|.|...:|.|:..:..|.|||..   |||.:...::..||..:|..::.
 Frog    64 HTFTME-FDDGDDTSVLRGGPFIGSYRLRQFHFHWGSSDGHGSEHKVDGMDYAAELHIVHWNSEK 127

  Fly   173 NNNF-------EYLTLSYLFALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGY 230
            .::|       :.|.:..:|......|.:::::||....|...|.......|. .|.|.|....:
 Frog   128 FSSFVEAACAPDGLAVLGVFLKIGEPNRYIERITDTFGAIRSKGKQSPFTNFD-PSCLLPASMDF 191

  Fly   231 FSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNCK------NGREKQPLGNR 289
            ::|.|:.....::...||::.::...:...||:.|.:|.........:      |.|..|||.||
 Frog   192 WTYPGSLTVPPLLESVTWVVLKEPISISHEQLARFRSLLFTKDTAEIEACCMKSNHRPVQPLKNR 256

  Fly   290 NV 291
            .|
 Frog   257 KV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 57/239 (24%)
ca13NP_001072448.1 alpha_CA 1..262 CDD:320708 62/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.