Sequence 1: | NP_611519.2 | Gene: | CAH14 / 37359 | FlyBaseID: | FBgn0034554 | Length: | 295 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070801.1 | Gene: | ca15c / 768190 | ZFINID: | ZDB-GENE-061013-737 | Length: | 324 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 53/270 - (19%) |
---|---|---|---|
Similarity: | 99/270 - (36%) | Gaps: | 84/270 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 SPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQF 138
Fly 139 VEAIFKWGSLK----SEHSIGKHNFCLELQALHRCAQLNNN------------------------ 175
Fly 176 -------FEYLTLSYLFALSHVKNEH----LKQVTDHLKWISQPGSSIELPPFHLESLLQPFG-S 228
Fly 229 GYFSYEG---TYDNGDVVLPTTW---------LINRKISVVDSRQLSEFEALYGRNGNRNCKNGR 281
Fly 282 EKQPLGNRNV 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CAH14 | NP_611519.2 | alpha_CARP_receptor_like | 69..293 | CDD:239396 | 53/270 (20%) |
ca15c | NP_001070801.1 | alpha_CA_IV_XV_like | 48..291 | CDD:239391 | 53/270 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170579188 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1377476at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR18952 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.040 |