DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and zgc:153760

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001070086.1 Gene:zgc:153760 / 767680 ZFINID:ZDB-GENE-060929-528 Length:324 Species:Danio rerio


Alignment Length:215 Identity:48/215 - (22%)
Similarity:88/215 - (40%) Gaps:34/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQFVEAIFKWGSLK----SEHSIGKHNFCLELQ 164
            |.:.|:|.:|::.:   :..:..:.|.:|.|.|..|:....|||..    |||::....:.:||.
Zfish    82 TSITNSGTSVVVSL---DEDIMSVQGGDLPGLYVSVQFHLHWGSSSSLPGSEHTVDGKQYAMELH 143

  Fly   165 ALHRCAQLNNNFE-YLTLSYLFALSHV-----------KNEHLKQVTDHLKWISQPGSSIE--LP 215
            .::..:..|.|.. .|..:...||:.:           |.......|..|..|...|::..  :.
Zfish   144 IVNLHSTYNGNVSAALAANDSSALAVLGFFIEGTDEADKTNSWDVFTSFLSNIPNSGNTYTDIMD 208

  Fly   216 PFHLESLLQPFG-SGYFSYEGTYD----NGDVVLPTTWLINRKISVVDSRQLSEF----EALYGR 271
            ...:.|||:... :.|:.|:|:..    |.||:    |.:.::...|::..::.|    .|...:
Zfish   209 QITMNSLLEGVNKTKYYRYQGSLTTPPCNEDVI----WTVFKEPIKVNNNLINRFCTKVFAKTAK 269

  Fly   272 NGNRNCKNGREKQPLGNRNV 291
            ..:.|..|.|..|||..|.|
Zfish   270 ASDLNVNNFRGVQPLNGRVV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 48/215 (22%)
zgc:153760NP_001070086.1 alpha_CA_IV_XV_like 48..291 CDD:239391 48/215 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.