DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and CA8

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:213 Identity:59/213 - (27%)
Similarity:90/213 - (42%) Gaps:44/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NNGNT--VIMRIYTANNFMPQLSGAELLGRYQF--VEAIFKWG---SLKSEHSIGKHNFCLELQA 165
            |:|:|  ||::..:.      |||..|...::|  .|..|.||   ...|||::....|.:||..
Human    84 NDGHTIQVILKSKSV------LSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHL 142

  Fly   166 LHRCAQLNNNFEY-------LTLSYLFALSHVKNEH--LKQVTDHLKWISQPGSSIELPPFHLES 221
            :|..:.|..:.:.       :.:..||.  .:..||  ||.||:.|:.|...|.|..:|.|:..:
Human   143 IHWNSTLFGSIDEAVGKPHGIAIIALFV--QIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNT 205

  Fly   222 LL-QPFGSGYFSYEGTYDNGDVVLP-----TTWLINRKISVVDSRQLSEFEAL----YGRNGNRN 276
            || .|....|:.|||:     :.:|     .||::.|....:...|:.||..|    .|......
Human   206 LLPDPLLRDYWVYEGS-----LTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEG 265

  Fly   277 C-----KNGREKQPLGNR 289
            |     .|.|..|||.:|
Human   266 CDGILGDNFRPTQPLSDR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 59/213 (28%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
alpha_CARP_VIII 35..289 CDD:239394 59/213 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.