DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and CA5A

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_011521611.1 Gene:CA5A / 763 HGNCID:1377 Length:376 Species:Homo sapiens


Alignment Length:98 Identity:27/98 - (27%)
Similarity:42/98 - (42%) Gaps:8/98 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIP-ESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQ 137
            |||.|. ..::...||| ||..:|  :......:.|.|....:....|.. ...:||..|...|:
Human    65 SPINIQWRDSVYDPQLK-PLRVSY--EAASCLYIWNTGYLFQVEFDDATE-ASGISGGPLENHYR 125

  Fly   138 FVEAIFKWGSLK---SEHSIGKHNFCLELQALH 167
            ..:..|.||::.   |||::..|.:..||..:|
Human   126 LKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVH 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 27/98 (28%)
CA5AXP_011521611.1 alpha_CA 61..>212 CDD:294017 27/98 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.