DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Car10

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001348636.1 Gene:Car10 / 72605 MGIID:1919855 Length:328 Species:Mus musculus


Alignment Length:317 Identity:67/317 - (21%)
Similarity:114/317 - (35%) Gaps:58/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MQLAEESRFIMM--LISCTMAVAFILNLYSGRTIFQDV--------------VNAVGNRRLEMKL 69
            |::..|..|::.  .|.|..|......::.|...:::|              ||:..|.   ..:
Mouse     1 MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNL---CSV 62

  Fly    70 AKQPSPITIPESNMIKRQLKMPLH---------WTYYEDLPMATVLENNGNTVIMRIYTANNFMP 125
            .|:.||:.|..|:||......||.         .|.|          |.|..|.:|:  ....:.
Mouse    63 GKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMY----------NTGRHVSLRL--DKEHLV 115

  Fly   126 QLSGAELLGRYQFVEAIFKWG---SLKSEHSIGKHNFCLELQALHRCAQLNNNFE--------YL 179
            .:||..:...::..|....:|   |..|||.:....|..|:|.:|...:|..|..        .:
Mouse   116 NISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLV 180

  Fly   180 TLSYLFALSHVKNEHLKQV--TDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDV 242
            .:|....:|...|..|.::  .|.:..|:....:..|...::|. |.|..|.:.:|:|:......
Mouse   181 VVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEE-LYPETSSFITYDGSMTIPPC 244

  Fly   243 VLPTTWLINRKISVVDSRQLSEFEALYGRNGNR----NCKNGREKQPLGNRNVYFNI 295
            ....:|:|..|...:...|:.....|.....::    ...|.|..|||.||.:..||
Mouse   245 YETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 54/249 (22%)
Car10NP_001348636.1 alpha_CARP_X_XI_like 46..302 CDD:239395 59/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.