DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and PTPRG

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_016862450.1 Gene:PTPRG / 5793 HGNCID:9671 Length:1485 Species:Homo sapiens


Alignment Length:263 Identity:54/263 - (20%)
Similarity:87/263 - (33%) Gaps:72/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 YEDLPM---------ATVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQFVEAIFKW----GSL 148
            |::|.:         .|.::|.|.||  .|...:::.  :|||.|.||::..:..|.|    ||.
Human    99 YQELQLDGFDNESSNKTWMKNTGKTV--AILLKDDYF--VSGAGLPGRFKAEKVEFHWGHSNGSA 159

  Fly   149 KSEHSIGKHNFCLELQALHR---CAQLNNNFEYLTL----------------------------- 181
            .|||||....|.:|.:....   ...|:....::.|                             
Human   160 GSEHSINGRRFPVEAEDARGGDIMLMLSQGMRFILLGLKKEQFEERKSWTTYQSMQIFFYNPDDF 224

  Fly   182 ----------------SYLFALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGY 230
                            :..|.:|...|..|..:...||.:........|.||.|..||......|
Human   225 DSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRDLLPASLGSY 289

  Fly   231 FSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNCK-------NGREKQPLGN 288
            :.|.|:...........|::.|:...:...||..|.:::......:.|       |.|.:|.|.:
Human   290 YRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQRLHD 354

  Fly   289 RNV 291
            |.|
Human   355 RVV 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 54/263 (21%)
PTPRGXP_016862450.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.