DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and car15

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_005169278.1 Gene:car15 / 568143 ZFINID:ZDB-GENE-091204-152 Length:312 Species:Danio rerio


Alignment Length:258 Identity:57/258 - (22%)
Similarity:102/258 - (39%) Gaps:65/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQL-KMPLH----------WTYYEDLPMATVLENNGNTVIMRIYTANNFMPQL 127
            |||.:....|....| .:.||          |           |.|.|::|::.:...    .|:
Zfish    50 SPINLDHHLMKNHSLDSLQLHGFNLTHKGQWW-----------LTNQGHSVVLEVGDG----MQV 99

  Fly   128 SGAELLGRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNFEYLT--------- 180
            ||..|...|:..:..|.|||:.   |||::....|.:|:..::    :.:....||         
Zfish   100 SGGGLPATYRTFQLHFHWGSVSSNGSEHTLDHLRFPMEMHIVN----IKSTHPNLTSALEDPTGI 160

  Fly   181 --LSYLFALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLL-QPFGSGYFSYEGTYDN--- 239
              |.....::::.||:.:.::..|.:::..|.:..:.||.|.:|| |...:.|:.|.|:...   
Zfish   161 AVLGVFVDVTYLHNENFQSISSALSYVAYKGQTKSIKPFPLVNLLPQNNLTQYYRYHGSLTTPPC 225

  Fly   240 GDVVLPTTWLINRKIS----------VVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNVY 292
            .:|||.|.:.:...||          :..:.:.:|.:||..       .|.|...|..:|.||
Zfish   226 SEVVLWTIYEVPVYISWAQFEQFVSGIYSTEEEAEIQALLH-------DNYRHIHPTYSRPVY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 57/258 (22%)
car15XP_005169278.1 alpha_CA_IV_XV_like 46..282 CDD:239391 57/258 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.