DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca9

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_009303384.1 Gene:ca9 / 566612 ZFINID:ZDB-GENE-080818-5 Length:384 Species:Danio rerio


Alignment Length:239 Identity:57/239 - (23%)
Similarity:99/239 - (41%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KQPSPITIPESNMIKRQLKMPLHWTYYEDL--PMATVLENNGNTVIMRIYTANNFMPQLSGAELL 133
            |..|||.|....::......|:....| ||  ..:..|.|||:|:.:.:.::   |....|.:.:
Zfish    62 KSQSPINIDTHKVLHEPRLPPIQLDGY-DLTGSHSLTLLNNGHTLQLSLPSS---MRIRRGFDQV 122

  Fly   134 GRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNFEYLT-----------LSYL 184
              |...:..|.||:.:   |||:|...::..|:..:|    .|:.:..||           |...
Zfish   123 --YVAAQLHFHWGTTEVPGSEHTIDNIHYPAEIHVVH----YNSKYANLTEAASKADGLAVLGGF 181

  Fly   185 FALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTW- 248
            .|:...:|::.:::...|..:|...|...:|.|::..||......::.|.|:......:...:| 
Zfish   182 IAIGLHENDNYEKILSALSDVSTEESLTVIPGFNVRHLLPNSLERFYRYSGSLTTPPCLQTVSWT 246

  Fly   249 LINRKISVVDSRQLSEF-EALYGRNGNRNCKNGREKQPLGNRNV 291
            |.|..|. |..|||:.. |:|...:.....||.|..|.|..|.:
Zfish   247 LFNDSIR-VSRRQLAALEESLKTEHNKLLSKNFRAPQLLHGRKI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 57/239 (24%)
ca9XP_009303384.1 alpha_CA_IX 48..294 CDD:239403 57/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.