DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca7

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_957107.1 Gene:ca7 / 564201 ZFINID:ZDB-GENE-040426-1786 Length:263 Species:Danio rerio


Alignment Length:254 Identity:68/254 - (26%)
Similarity:107/254 - (42%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QDVVNAVGNRRLEMKLAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIY 118
            :|...|.|||:         |||.|..|..:......|:..:|.....::  :.|||::|::. :
Zfish    19 KDYPIAEGNRQ---------SPIDIVPSEAVFDSKLSPISLSYNNCTSLS--ISNNGHSVVVE-F 71

  Fly   119 TANNFMPQLSGAELLGRYQFVEAIFKWGS---LKSEHSIGKHNFCLELQALHRCAQLNNNFEYLT 180
            ...:....::|..|...|:..:..|.|||   ..|||::....|..||..:|..|....:|....
Zfish    72 VDTDERSVITGGPLENMYRLKQFHFHWGSKGCCGSEHTVAGKTFVSELHLVHWNANKYKSFSEAA 136

  Fly   181 -----LSYLFALSHVKNEH--LKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYD 238
                 |:.|.......:||  |.|:||.|..:...||..|...|:.:.|| |....|::|.|:..
Zfish   137 AAPDGLAVLGIFLETGDEHRALHQITDALYMVRFKGSLAEFKGFNPKCLL-PNSLEYWTYPGSLT 200

  Fly   239 NGDVVLPTTWLINRKISVVDSRQLSEFEALYGRNG------NRNCKNGREKQPLGNRNV 291
            ...:....||::.::...|..:|:.:|..|. .||      ||...|.|..|||..|.|
Zfish   201 TPPLYESVTWIVLKEPIYVSEKQMGKFRTLL-FNGEEEEDRNRMENNYRPPQPLKGRMV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 63/239 (26%)
ca7NP_957107.1 alpha_CA_VII 26..262 CDD:239402 66/247 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579233
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.