DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca8

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001017571.2 Gene:ca8 / 550233 ZFINID:ZDB-GENE-050417-26 Length:281 Species:Danio rerio


Alignment Length:208 Identity:59/208 - (28%)
Similarity:88/208 - (42%) Gaps:30/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NNGNTVIMRIYTANNFMPQLSGAELLG--RYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALH 167
            |:|:||  ||...:..:  ::|..|..  .|:..|..|.||...   |||::....|.:||..:|
Zfish    75 NDGHTV--RIMLKSKSV--VTGGPLPSDHEYELSEVRFHWGKENQRGSEHTVNFKAFPMELHLIH 135

  Fly   168 RCAQLNNNFEY-------LTLSYLFALSHVKNEH--LKQVTDHLKWISQPGSSIELPPFHLESLL 223
            ..:.|.|:.|.       :.:..||.  .|..||  ||.:||.|:.:...|.:..:|.|:..:||
Zfish   136 WNSTLFNSVEEAMGKKRGILIIALFV--QVGKEHLGLKAITDVLQDLQYKGKTKIIPCFNPNTLL 198

  Fly   224 -QPFGSGYFSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYGR-------NGNRNC--K 278
             .|....|:.|||:..........||::.|....:...|:.||..|...       .||...  .
Zfish   199 PDPLLRDYWVYEGSLTTPPCSENVTWILYRYPLTISQMQIEEFRRLRSHVKGAELPEGNDGMLGD 263

  Fly   279 NGREKQPLGNRNV 291
            |.|..|||.:|.|
Zfish   264 NFRPTQPLSDRVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 59/208 (28%)
ca8NP_001017571.2 alpha_CARP_VIII 25..280 CDD:239394 59/208 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.