DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca7

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001015903.1 Gene:ca7 / 548657 XenbaseID:XB-GENE-1017206 Length:266 Species:Xenopus tropicalis


Alignment Length:249 Identity:59/249 - (23%)
Similarity:108/249 - (43%) Gaps:29/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AVGNRRLEMKLAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNF 123
            |.|||:         |||.|..:..:......||..:|  |...:..|.|||::|::. :...:.
 Frog    25 AEGNRQ---------SPIDIVSNQAVFNPSLNPLVISY--DHCTSINLSNNGHSVMVE-FDDYDD 77

  Fly   124 MPQLSGAELLGRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNF-------EY 178
            ...::|..|.|.|:..:..|.||:.:   |||::...::..||..:|..|:..::|       :.
 Frog    78 KTVITGGPLEGSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELHLVHWNARAYSSFGEAAAAPDG 142

  Fly   179 LTLSYLFALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVV 243
            |.:..:|..:..::..|.::||.|..:...|:..:...|:.:.|| |....|::|.|:.....:.
 Frog   143 LVVIGVFLETGGQHSGLNRLTDALYMVKFKGTKTQFDDFNPKCLL-PSSFEYWTYPGSLTTPPLN 206

  Fly   244 LPTTWLINRKISVVDSRQLSEFEALYGRNGNRN------CKNGREKQPLGNRNV 291
            ...||::.::...|..:|:..|......:|...      ..|.|..|||..|.|
 Frog   207 ESVTWIVLKEPIKVSEKQMERFRKTLLFSGEEEEQRIHMVNNFRPPQPLKGRKV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 55/239 (23%)
ca7NP_001015903.1 alpha_CA_VII 27..264 CDD:239402 58/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.