DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca2

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001015729.1 Gene:ca2 / 548446 XenbaseID:XB-GENE-484348 Length:260 Species:Xenopus tropicalis


Alignment Length:246 Identity:63/246 - (25%)
Similarity:106/246 - (43%) Gaps:47/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLK-----MPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELL 133
            |||     |::..:.|     .|:...|  |...|.|:.|||:...:. :..:.....|||..:.
 Frog    29 SPI-----NIVSAEAKYDHHLKPISIKY--DPSTAKVILNNGHAFNVE-FDDSEDKSVLSGGAVS 85

  Fly   134 GRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNFEYLTLSYLFALSH------ 189
            ..|:..:..|.|||..   |||::....:..||..:|.      |.:|.:::.  |:.|      
 Frog    86 HPYRLKQFHFHWGSCDGHGSEHTVDGVKYEAELHLVHW------NTKYASMAE--AVKHCDGLAV 142

  Fly   190 ------VKNEH--LKQVTDHLKWISQPGSSIELPPF--HLESLLQPFGSGYFSYEGTYDNGDVVL 244
                  |...|  |::|.|.||.|...|:.   .||  :..|:|.|....:::|:|:.....::.
 Frog   143 VGVFLKVGEAHPGLQKVLDALKLIPNKGNE---APFTDYDPSVLLPNSLDFWNYKGSLTTPPLLQ 204

  Fly   245 PTTWLINRKISVVDSRQLSEFEAL-YGRNGNRNC---KNGREKQPLGNRNV 291
            ...|.:.|:...|.::|||:..:| :...|:..|   .|.|..|||.:|:|
 Frog   205 CVLWHVLREPIAVSNQQLSQLRSLFFNAEGDTPCCMVDNFRPPQPLKSRHV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 63/246 (26%)
ca2NP_001015729.1 alpha_CA 1..259 CDD:381753 63/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.