DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Ca13

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001128465.1 Gene:Ca13 / 499566 RGDID:1560453 Length:262 Species:Rattus norvegicus


Alignment Length:234 Identity:58/234 - (24%)
Similarity:94/234 - (40%) Gaps:18/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELLGRY 136
            |.|||.|....:.......||...|  |...|.::.|:|::..:. :........|.|..|.|.|
  Rat    28 QQSPIEIKTKEVKYDSSLRPLSIKY--DPASAKIISNSGHSFNVD-FDDTEDKSVLRGGPLTGSY 89

  Fly   137 QFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNF-------EYLTLSYLFALSHVK 191
            :..:....|||..   |||.:....:..||..:|..:....:|       :.|.:..:|......
  Rat    90 RLRQFHLHWGSADDHGSEHVVDGVRYAAELHVVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEH 154

  Fly   192 NEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLINRKISV 256
            |..|:::||.|..|.:.|.......|....|| |....|::|.|:.....::...||::.::...
  Rat   155 NPQLQKITDILDSIKEKGKQTRFTNFDPLCLL-PSSWDYWTYPGSLTVPPLLESVTWIVLKQPIS 218

  Fly   257 VDSRQLSEFEALY----GRNGNRNCKNGREKQPLGNRNV 291
            :.|:||:.|.:|.    |.:......|.|..|||..|.|
  Rat   219 ISSQQLARFRSLLCTAEGESAAFLLSNHRPPQPLKGRRV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 58/234 (25%)
Ca13NP_001128465.1 alpha_CA_I_II_III_XIII 2..261 CDD:239393 58/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.