DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and ca8

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001011213.1 Gene:ca8 / 496646 XenbaseID:XB-GENE-953676 Length:282 Species:Xenopus tropicalis


Alignment Length:179 Identity:50/179 - (27%)
Similarity:75/179 - (41%) Gaps:30/179 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNFEY-------LTLSYLFALSHV 190
            |:..|..|.||...   |||::....|.:||..:|..:.|..:.|.       :.:..||.....
 Frog   102 YELNEVRFHWGKENQRGSEHTVNFKAFPMELHLIHWNSTLYRSLEEAMGKVHGIVIISLFVQIGK 166

  Fly   191 KNEHLKQVTDHLKWISQPGSSIELPPFHLESLL-QPFGSGYFSYEGTYDNGDVVLP-----TTWL 249
            :|..||.:|:.|:.|...|.|..:|.|:..:|| .|....|:.|||:     :.:|     .||:
 Frog   167 ENIGLKAITEVLQDIFYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGS-----LTMPPCSEGVTWI 226

  Fly   250 INRKISVVDSRQLSEFEAL----YGRNGNRNC-----KNGREKQPLGNR 289
            :.|....|...|:.||..|    .|.:....|     .|.|..|||.:|
 Frog   227 LFRYPLTVSQTQIEEFRRLRTHIKGADLPDGCDGLMADNFRPTQPLSDR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 50/179 (28%)
ca8NP_001011213.1 alpha_CARP_VIII 26..281 CDD:239394 50/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.