DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and CAH6

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster


Alignment Length:248 Identity:66/248 - (26%)
Similarity:108/248 - (43%) Gaps:30/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KQPSPITIPESNMIKRQLKMPL----HWTYYEDLPMATVLENNGNTVIMRI-YTANNFMPQLSGA 130
            ::.|||::    .:::.|.:||    ...|...|.....|.|||:|..:.| .|||...|.::|.
  Fly    47 ERQSPISL----NVQKSLIVPLPRIVFGNYDVKLRGPLTLLNNGHTAHVEIPETANGNKPFITGG 107

  Fly   131 ELLGRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHR------CAQLNNNFEYLTLSYLFA 186
            .|.||:......|.|||..   |||||.:..|.:|:..:||      ..:..|..:.:.:..:. 
  Fly   108 LLKGRFVAEAFHFHWGSPSSRGSEHSINQQRFDVEMHIVHRNEKYGDIDEAKNKKDGIAVIGVM- 171

  Fly   187 LSHVKNEH-----LKQVTDHLKWISQPGSSIELPPFHLESLLQPFGS----GYFSYEGTYDNGDV 242
            |..|||.:     |.:|...|..:::..:...:|..  .||.|..|:    .:|:|.|:......
  Fly   172 LKIVKNPNRIFPGLSKVMSALPRVTKYNAKTTIPGG--LSLGQMLGNVNPRDFFTYRGSLTTPLC 234

  Fly   243 VLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNVYFNI 295
            ....||.:..::..|....:|:|..|....|:|...|.|:.||...|.|::.|
  Fly   235 EQSVTWTVFSQVLPVPYSSVSKFWKLRDSEGHRLINNFRDIQPRNGRPVFYRI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 65/244 (27%)
CAH6NP_001097987.1 Carb_anhydrase 30..282 CDD:215000 63/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.