DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and CAH9

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster


Alignment Length:250 Identity:63/250 - (25%)
Similarity:98/250 - (39%) Gaps:38/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTAN------NFMPQLSG 129
            |..|||.|..|......:.......|:..||....:.|||:||.:.|...|      :|:|.:.|
  Fly    45 KTQSPIAITTSRTTAIHMPAVDMIGYHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRG 109

  Fly   130 AELLGRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNFEYLT----------- 180
            |:|.|.::.....|.||...   |||.|....:.:|:..:||      |.:|.|           
  Fly   110 AKLPGEFEVEGLHFHWGDKNNRGSEHVINDIRYTMEMHIVHR------NKKYATIGEALNHPDGA 168

  Fly   181 --LSYLFALSHVKNEHLKQVTDHLKWISQPGSSIEL-PPFHLESLLQPFGSG-----YFSYEGTY 237
              |.:.|.|...:...|..:..||..|:.......| ..|.|.||:    :|     :::|:|:.
  Fly   169 AVLGFFFNLDEDEGAGLVTINRHLHLIADANQEATLNVTFSLSSLI----AGVDVDKFYTYKGSL 229

  Fly   238 DNGDVVLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNVY 292
            .........||::......:..:|:|.|..|..........|.|..||:|||.::
  Fly   230 TTPPCSEAVTWILFPDPIPISPKQISRFRQLSDTQDGALVDNFRTLQPVGNRRIF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 63/249 (25%)
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 62/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.