DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and CAH4

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster


Alignment Length:256 Identity:62/256 - (24%)
Similarity:104/256 - (40%) Gaps:35/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RRLEMKLAKQPSPITIPESNMIKRQLKMPLHWTYYEDL--PMATVLENNGNTVIMRI-YTANNFM 124
            |...:|..::.|||.:...|.|...:.......|::.|  |::.:  |||.||:||| .|.:...
  Fly    28 RDWNVKCGERQSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVI--NNGLTVLMRIPKTVDGSR 90

  Fly   125 PQL----SGAELLGRYQFVEAIFKWGSL---KSEHSIGKHNFCLELQALHRCAQLNNNFE----- 177
            |.|    .|.::   ::..:..|.|||.   .|||.:..:.:..|:..:|:.|...:|.|     
  Fly    91 PSLCISTEGQQV---FEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQP 152

  Fly   178 --YLTLSYLFALSHVKNEHLKQVTDHLKWISQPGSSI----ELPPFHLESLLQP-FGS----GYF 231
              :..|: || :.::::.:::  |..:..|.:..|||    :..|......||. |.|    .||
  Fly   153 NGFAVLA-LF-IRNLEDPNIE--TPAMNMICKQVSSITKLDDSCPLEDSMALQDLFASIDSQKYF 213

  Fly   232 SYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNVY 292
            :|:|:...........|.:......|.......|..|......|.....||.|...:|.||
  Fly   214 TYQGSLTTPPCAEAVIWFVFPTPLDVPKELWKHFWQLRDSRDQRVLNTYRELQDGHDRPVY 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 60/250 (24%)
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 58/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.