DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and CAH15

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster


Alignment Length:304 Identity:94/304 - (30%)
Similarity:145/304 - (47%) Gaps:36/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EESRFIMMLISCTMAVAFILNLYSGRTIF--------QDVVNAVGN--RRLEMK----------- 68
            ::|..:..:::..:|:..:.|:|:|.::.        ....||.|:  |||...           
  Fly    25 QDSNLLKFILAIGVALLVLFNVYTGFSLANRCDEGSNDGCANAGGDNCRRLRGSPESYNYDWDQG 89

  Fly    69 ------LAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQL 127
                  .....|||.|..:.:.......||.|::|..:|:...|||||:|:|:|...... .|.:
  Fly    90 PHTWDTACNNQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRLENNGHTLILRAAFPER-TPSI 153

  Fly   128 SGAELLGRYQFVEAIFKW---GSLKSEHSIGKHNFCLELQALHR----CAQLNNNFEYLTLSYLF 185
            .|.:||||:.|.|..|:|   .||.|||::..|:..||:|.||.    |...:::...|.:||:|
  Fly   154 DGGDLLGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTDGDGCDGCSSSQGVLMISYMF 218

  Fly   186 ALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLI 250
            .||. .|..|..:..||..:.|.|..:|:|||.|..|:.||...::||.|:...........|||
  Fly   219 DLSE-HNPFLDVLIQHLAAVEQAGQVVEVPPFPLSYLMSPFYDKFYSYNGSLTEPPCHRGAEWLI 282

  Fly   251 NRKISVVDSRQLSEFEALYGRNGNRNCKNGREKQPLGNRNVYFN 294
            ..:...:..|||:||..|..|.|:|..:|.|..||:|:|.||.|
  Fly   283 YPESLAISERQLNEFRQLRDRRGSRIARNARPVQPIGDRMVYLN 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 81/230 (35%)
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 81/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119978
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0014307
OrthoInspector 1 1.000 - - otm49924
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.