DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Ca12

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:245 Identity:61/245 - (24%)
Similarity:100/245 - (40%) Gaps:35/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKM-PLHWTYYE-DLPMATVLENNGNTVIMRIYT---ANNFMPQLSGAELL 133
            |||.: .|::::....: ||.:..|. .:.....|.|:|::|.:.:.:   .....|....||.|
  Rat    56 SPIDL-HSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHQYRAEQL 119

  Fly   134 GRYQFVEAIFKWGSLK----SEHSI-GKHNFCLELQALHRCAQLNNNF-------EYL-TLSYLF 185
            ..:        ||:..    |||:: ||| |..||..:|..:.|.::|       |.| .|:.|.
  Rat   120 HLH--------WGNRNDPHGSEHTVSGKH-FAAELHIVHYNSDLYSDFGSASDKSEGLAVLAVLI 175

  Fly   186 ALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLI 250
            .:..| |....::..||:.:...|..:.:|.|::|.||......|:.|||:...........|.:
  Rat   176 EIGSV-NPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTV 239

  Fly   251 NRKISVVDSRQLSEFE-ALY-----GRNGNRNCKNGREKQPLGNRNVYFN 294
            .|....:...||...| |||     ..:......|.|:.|....|.||.:
  Rat   240 FRNPVQISQEQLLALETALYFTHMDDPSPREMVNNFRQVQKFDERLVYIS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 60/242 (25%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 61/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.