DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and CAH13

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster


Alignment Length:230 Identity:77/230 - (33%)
Similarity:120/230 - (52%) Gaps:11/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQF 138
            ||:.|.||.:.:..::..|.|.:|:|||.:..|||.|.|:|:|.....| .|.:|||:||..|.|
  Fly   113 SPVNIDESQIQRMAIRELLSWNHYDDLPASITLENTGQTLILRAQFHGN-APTISGADLLASYTF 176

  Fly   139 VEAIFKWG---SLKSEHSIGKHNFCLELQALHRCAQ-----LNNNFEYLTLSYLFALSHVKNEHL 195
            :|..|.||   |..|||:|....|.||:|.:|:...     ..::::.|.:.|:|.|| ..|..|
  Fly   177 LELRFHWGWCNSEGSEHTINHRKFPLEMQVMHKTGSGIPRTCTSSYDLLMIGYVFELS-AHNPFL 240

  Fly   196 KQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLINRKISVVDSR 260
            ..:..:|:.:.:||..:::.||.:..|:..|.||::||.|:..:......|.|.|..:...:...
  Fly   241 DPLVQNLRLVQKPGKRVQISPFPISYLMYQFRSGFYSYGGSLTHPPCYQGTEWFIFPESLAISDF 305

  Fly   261 QLSEFEALYGRNG-NRNCKNGREKQPLGNRNVYFN 294
            ||..|..|.|.:| :...:|.|..|.:|||.|..|
  Fly   306 QLRHFRLLLGPDGISPIARNSRPVQHMGNRVVSLN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 76/227 (33%)
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 76/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119978
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0014307
OrthoInspector 1 1.000 - - otm49924
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.