DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Ca9

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001101426.1 Gene:Ca9 / 313495 RGDID:1306426 Length:437 Species:Rattus norvegicus


Alignment Length:262 Identity:70/262 - (26%)
Similarity:109/262 - (41%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YSGRTIFQDVVNAVGNRRLEMKLAKQPSPITIP-ESNMIKRQLKMPLHWTYYE--DLPMATVLEN 108
            |.|..::..|..|...|        ..||:.|. |.....|.|: ||....||  .||..: |.|
  Rat   122 YGGTLLWPQVSPACAGR--------FQSPVDIRLELTSFCRTLQ-PLELLGYELQSLPELS-LCN 176

  Fly   109 NGNTVIMRIYTANNFMPQLSGAELLG---RYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALH 167
            ||:||.:.:      .|.|.  .:||   .|:.::....||:..   |||::..|.|..|:..:|
  Rat   177 NGHTVQLTL------PPGLK--MVLGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVH 233

  Fly   168 RCAQLNNNFEYL-------TLSYLFALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQP 225
            .....:...|.|       .|:.....|..:|...:|:..||:.|::.||.||:|...:.:||..
  Rat   234 LSTAFSELHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSKIEIPGLDVSALLPS 298

  Fly   226 FGSGYFSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFE-ALYGRNGNRNCKNGREKQPLGNR 289
            ..|.|:.|||:...........|.:..:...:.::||.... :|:|...:|...|.|..|||..|
  Rat   299 DLSRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGLRDSRLQLNFRATQPLNGR 363

  Fly   290 NV 291
            .:
  Rat   364 TI 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 65/240 (27%)
Ca9NP_001101426.1 alpha_CA 128..370 CDD:294017 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.