DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Ca8

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:211 Identity:57/211 - (27%)
Similarity:89/211 - (42%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NNGNT--VIMRIYTANNFMPQLSGAELLGRYQFVEAIFKWG---SLKSEHSIGKHNFCLELQALH 167
            |:|:|  ||::..:..:..|...|.|    ::..|..|.||   ...|||::....|.:||..:|
  Rat    84 NDGHTIQVILKSKSVLSGGPLPQGQE----FELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIH 144

  Fly   168 RCAQLNNNFEY-------LTLSYLFALSHVKNEH--LKQVTDHLKWISQPGSSIELPPFHLESLL 223
            ..:.|..:.:.       :.:..||.  .:..||  ||.||:.|:.|...|.|..:|.|:..:||
  Rat   145 WNSTLFGSIDEAVGKPHGIVIIALFV--QIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLL 207

  Fly   224 -QPFGSGYFSYEGTYDNGDVVLP-----TTWLINRKISVVDSRQLSEFEAL----YGRNGNRNC- 277
             .|....|:.|||:     :.:|     .||::.|....:...|:.||..|    .|......| 
  Rat   208 PDPLLRDYWVYEGS-----LTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCD 267

  Fly   278 ----KNGREKQPLGNR 289
                .|.|..|||.:|
  Rat   268 GILGDNFRPTQPLSDR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 57/211 (27%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 57/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.