DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Car7

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001099635.1 Gene:Car7 / 291819 RGDID:1306842 Length:264 Species:Rattus norvegicus


Alignment Length:247 Identity:59/247 - (23%)
Similarity:109/247 - (44%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AVGNRRLEMKLAKQPSPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNF 123
            |.|:|:         |||.|..|..:......||. .:||.. |:..:.|||::|.:. :..::.
  Rat    25 AQGDRQ---------SPINIISSQAVYSPSLQPLE-LFYEAC-MSLSITNNGHSVQVD-FNDSDD 77

  Fly   124 MPQLSGAELLGRYQFVEAIFKWGSLK---SEHSIGKHNFCLELQALHRCAQLNNNF-------EY 178
            ...::|..|.|.|:..:..|.||..:   |||::...:|..||..:|..|:..:.|       :.
  Rat    78 RTVVAGGPLEGPYRLKQLHFHWGKKRDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAAAAPDG 142

  Fly   179 LTLSYLFALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVV 243
            |.:..:|..:..::..:.::||.|..:....:..:...|:.:.|| |....|::|.|:.....:.
  Rat   143 LAVVGIFLETGDEHPSMNRLTDALYMVRFKDTKAQFSCFNPKCLL-PTSRHYWTYPGSLTTPPLS 206

  Fly   244 LPTTWLINRKISVVDSRQLSEFEALYGRNGN----RNCKNGREKQPLGNRNV 291
            ...||::.|:...:..||:.:|.:|...:.:    ....|.|..|||..|.|
  Rat   207 ESVTWIVLREPIRISERQMEKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 56/237 (24%)
Car7NP_001099635.1 alpha_CA_VII 27..262 CDD:239402 58/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.