DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Car15

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:244 Identity:62/244 - (25%)
Similarity:108/244 - (44%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKM-PLHWTYYEDLPM-ATVLENNGNTVIMRIYTANNFMPQLSGAEL-LGR 135
            ||:.| :..:::|...: |..:..|:..|. ..:|||:|:||::|:::.....|.:.||.| ...
  Rat    51 SPVNI-DLRLVQRDYALKPFIFHGYDSAPQDPWILENDGHTVLLRVHSCQQNCPAIRGAGLPSSE 114

  Fly   136 YQFVEAIFKWGS---LKSEHSIGKHNFCLELQALHRCAQLNNNFEYL-----------TLSYLFA 186
            |:.::..|.|||   ..||||:.:.:..:|:..:|    :|..::.:           .|:.|..
  Rat   115 YRLLQLHFHWGSPGHKGSEHSVDEKHGSMEMHMVH----MNTKYQSMGHARSQPDGLAILAVLLV 175

  Fly   187 LSHVKNEHLKQVTDHLKWISQPGSSIEL-PPFHLESLLQPFGSG---YFSYEGTYDNGDVVLPTT 247
            .....|.:...:...||.:|.||.|:.| ..|.|.||| |...|   |:.|.|:...........
  Rat   176 EEDKDNTNFSAIVSGLKNVSSPGVSVNLTSTFALASLL-PSALGLLRYYRYSGSLTTPGCEPAVL 239

  Fly   248 WLINRKISVVDSRQLSEFEAL-----YGRNGNRNCKNGREKQPLGNRNV 291
            |.:......:...|:.:|:|:     .|.:......|.|.:||||.|.:
  Rat   240 WTVFENTVPIGHAQVVQFQAVPQTGPPGLHPRPLTDNFRPQQPLGGRRI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 62/244 (25%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339492
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.