DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Car14

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:XP_006501505.1 Gene:Car14 / 23831 MGIID:1344341 Length:460 Species:Mus musculus


Alignment Length:247 Identity:53/247 - (21%)
Similarity:83/247 - (33%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKMPLHWTYYEDLPMATV------------LENNGNTVIMRIYTANNFMPQ 126
            |||.|...::|           :..|||....            |.|||:||.:      :..|.
Mouse    46 SPINIQTDSVI-----------FDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQL------SLPPT 93

  Fly   127 LSGAELLGRYQFVEAIFKW---GSLK-SEHSIGKHNFCLELQALHRCAQLNNNFE--------YL 179
            |....|..:|...:....|   |||: |||.|.......||..:|..:|..::..        ..
Mouse    94 LHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLA 158

  Fly   180 TLSYLFALSHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVL 244
            .|..|..:...:|.....:...|..|........:|||.:..|.......:|.|.|:........
Mouse   159 VLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQ 223

  Fly   245 PTTWLINRKISVVDSRQLSEF-EALYGRNGNRN---CKNGREKQPLGNRNVY 292
            ...|.:..:.:.:...||.:. |.|.....:.:   .:|.|..|||..|.::
Mouse   224 SVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 53/247 (21%)
Car14XP_006501505.1 alpha_CA_XII_XIV 29..278 CDD:239400 53/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.