DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and cah-3

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001370788.1 Gene:cah-3 / 181713 WormBaseID:WBGene00000281 Length:246 Species:Caenorhabditis elegans


Alignment Length:221 Identity:50/221 - (22%)
Similarity:85/221 - (38%) Gaps:8/221 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQF 138
            |||.|....:.::.....:.:..| |.|:...:.|||::|.|.....:.. |::.|..|...|:.
 Worm    25 SPINIDLGEVERKDTHDGIKFVNY-DHPIQGDIVNNGHSVQMTPELRSEH-PEIYGGGLDQVYRL 87

  Fly   139 VEAIFKWG---SLKSEHSIGKHNFCLELQALHRCAQLNNNFEYLTLSYLFALSHVKNEHLKQVTD 200
            |:..|.||   :..|||::|...:..||..:|:..:....   |.:..:|.....:.:.|.....
 Worm    88 VQYHFHWGENDNEGSEHTLGGLRYPAELHLVHQGVEDPGK---LAVVGVFLQLGKEGKALSNEER 149

  Fly   201 HLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEF 265
            .|..:..|.:...:....|...|......::.|||:..........||.|..:...|...||..|
 Worm   150 VLGKLCNPETVTRVENVRLSEKLPANKRSFWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELF 214

  Fly   266 EALYGRNGNRNCKNGREKQPLGNRNV 291
            ..:.........||.|..|.|.:|.:
 Worm   215 RQVQDIEKRPIKKNYRPTQNLNDRKI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 50/221 (23%)
cah-3NP_001370788.1 Carb_anhydrase 5..239 CDD:215000 49/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.