DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and cah-2

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_495567.3 Gene:cah-2 / 174218 WormBaseID:WBGene00000280 Length:337 Species:Caenorhabditis elegans


Alignment Length:261 Identity:57/261 - (21%)
Similarity:101/261 - (38%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SPITIPESNMIKRQLKMPLHWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLS---GAELLGR 135
            ||:.|..|.::.....||::   .|...:..|.||.|...::.:....| .|.::   |..:..|
 Worm    37 SPVNIDPSQLLYDPHLMPIN---IEGNIVEAVFENTGQLPVVTVKDLPN-RPTINITGGPTMPYR 97

  Fly   136 YQFVEAIFKWGSLK-----SEHSIGKHNFCLELQALHRCAQLNNNFE--------YLTLSYLFAL 187
            |:..:....:|...     |||::.:..|..|:|.|...:.|..||.        .|.:|.:..:
 Worm    98 YKLHQISVHFGRADEGEKGSEHTVDRVRFPAEIQLLAYNSALYPNFSVAMTSPRGLLAVSVIVDI 162

  Fly   188 SHVKNEHLKQVTDHLKWISQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLI-- 250
            ....:..|:::|...:.|:..|.:..|..|...:|| |..|.|.:|||:..........||:|  
 Worm   163 GKTTSVELRRLTVASQSINYKGQTTNLTDFQPSALL-PKTSHYVTYEGSLTFPGCHETVTWVILN 226

  Fly   251 ------NRKISVVDSRQLSE---------------FEALYGRNGNRNCKNGREKQPLGN---RNV 291
                  |..:.:.:..|.:|               .::|.||....|...|.::..:.:   .||
 Worm   227 NPIYITNDDLQIWNEMQKTETKQPEPSYMTPAYRPLKSLNGRLVRTNINVGSKQSTVSSSCPSNV 291

  Fly   292 Y 292
            |
 Worm   292 Y 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 57/261 (22%)
cah-2NP_495567.3 alpha_CARP_X_XI_like 16..275 CDD:239395 53/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.