DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH14 and Ptprg

DIOPT Version :9

Sequence 1:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_599183.2 Gene:Ptprg / 171357 RGDID:620774 Length:1442 Species:Rattus norvegicus


Alignment Length:223 Identity:53/223 - (23%)
Similarity:88/223 - (39%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 YEDLPM---------ATVLENNGNTVIMRIYTANNFMPQLSGAELLGRYQFVEAIFKW----GSL 148
            |::|.:         .|.::|.|.||  .|...:::.  :|||.|.||::..:..|.|    ||.
  Rat    99 YQELQLDGFDNESSNKTWMKNTGKTV--AILLKDDYF--VSGAGLPGRFKAEKVEFHWGHSNGSA 159

  Fly   149 KSEHSIGKHNFCLELQALHRCAQLNNNFEYL--------TLSYLFALSHVKNEHLKQVTDHLKWI 205
            .||||:....|.:|:|.........::|:..        .::..|.:|...|..|..:...||.:
  Rat   160 GSEHSVNGRRFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGV 224

  Fly   206 SQPGSSIELPPFHLESLLQPFGSGYFSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYG 270
            ........|.||.|..||......|:.|.|:...........|::.|:...:...||..|.:::.
  Rat   225 VHHEKETFLDPFVLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFT 289

  Fly   271 RNGNRNCK-------NGREKQPLGNRNV 291
            .....:.|       |.|.:|.|.:|.|
  Rat   290 TEQQDHVKSVEYLRNNFRPQQALNDRVV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 53/223 (24%)
PtprgNP_599183.2 alpha_CARP_receptor_like 67..319 CDD:239396 53/223 (24%)
FN3 348..438 CDD:238020
R-PTPc-G-1 845..1118 CDD:350505
R-PTP-G-2 1202..1406 CDD:350508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.